Adrenomedullin (AM) (13-52), (human)

Cat. No: CDIA-1597

CAS. No.: 154765-05-6

Size: 50 mg

Price: Inquiry

Product Details
Formula	C200H308N58O59S2
Molecular Weight	4533.10
Sequence	Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21)
Sequence Shortening	SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.

! For research use only. Not intended for any clinical use.