Adrenomedullin (11-50), (rat)

Cat. No: CDIA-1584

CAS. No.: 163648-32-6

Size: 50 mg

Price: Inquiry

Product Details
Formula	C194H304N58O59S4
Molecular Weight	4521.17
Sequence	Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge: Cys4-Cys9)
Sequence Shortening	STGCRFGTCTMQKLAHQIYQFTDKDKDGMAP RNKISPQGY-NH2(Disulfide bridge: Cys4-Cys9)

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors.

! For research use only. Not intended for any clinical use.