Adrenomedullin (1-50), (rat)
Online Inquiry
* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Adrenomedullin (1-50), (rat)

Cat. No: CDIA-0990
Size: 5 mg
Price: Inquiry
Product Details
Formula C242H381N77O75S5
Molecular Weight 5729.50
Appearance Solid
Purity 99.34%
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19)
Sequence Shortening YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19)
Storage & Handling
Shipping Room temperature.
Storage Sealed storage, away from moisture and light, under nitrogen *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Storage Powder -80 °C/2 years, -20 °C/1 year

Description

Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor.

! For research use only. Not intended for any clinical use.